SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00003219001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00003219001
Domain Number - Region: 28-46
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0602
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00003219001
Sequence length 252
Comment (Vitis vinifera)
Sequence
MTRRLEELELKRIHEVQAVAEASVQVKLCPNCQSYEHLVEECPAISAEREMFRDQANVVG
QFRPNNNAPYGNTYNSSWRNHPNFSWKARATQYQQSDPPSQQSSSLEQAMTNLSKVVGDF
IGNQEATNAQIYQRIDRVESMLNKRMDGMQNDMNQKFDNIQYSISRLTNLNTLQEKGRFP
SQPHQNPKGVYEVEIQEGESSQTKDVKALITLRSGKKIEKPTPEPYEMEDKENEIIFLKL
NFEDYNIFYYSE
Download sequence
Identical sequences 29760.GSVIVG00003219001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]