SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00034313001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00034313001
Domain Number 1 Region: 108-163
Classification Level Classification E-value
Superfamily Homeodomain-like 1.35e-16
Family Myb/SANT domain 0.054
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00034313001
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00314
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00034313001
Sequence length 358
Comment (Vitis vinifera)
Sequence
MTRRCSHCSTNGHNSRTCPSRGGGAVAGGIGGVKLFGVRLTDGSIIKKSASMGSLSSAHY
HSSSSAAASPNPSSPSSDPLRDAIHEPDGYLSDDPGQATCSSNRRGERKKGVPWTEEEHR
LFLFGLQRLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQSNATRRKRRSSLFDMVPDM
VTDTPPVPEEQFLVPTSQTGETDNASSVPSLNLSLNMEFEPMETISQETVKEAEEAEETV
IPRSELPPVVPAFFPGYLPVPFPFWPPNAASAEEEKESESSHQVLKPIPVLPKEPVNVDE
LVGMSQLSLGEINNGHIDSSPLSLKLLGAPSRQSAFHTNTSVGGSELGKGKNSVVQAV
Download sequence
Identical sequences D7U0C1
XP_002283785.1.54126 29760.GSVIVG00034313001 GSVIVT01016996001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]