SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_0232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_0232
Domain Number 1 Region: 68-149
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 6.15e-16
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0031
Further Details:      
 
Domain Number 2 Region: 152-208
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.0000000000000484
Family Head domain of nucleotide exchange factor GrpE 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_0232
Sequence length 278
Comment (Frankia EAN1pec)
Sequence
MTSAHGEHRLDDSRAGGDGGPEEPIVKDRRRIDPETGQVRGSAAGAATPGAEPMGPAGAG
PADSDSELVASLRGQLGERTADLQRLKAEFDNYRRRAARERDAAGDQAVSKLLGGLLGVL
DDIGRARDHGDLEGPFKAIAESLETALESTGLERFGTPGEVFDPHLHHALMHSYRSDVSE
TTCVEIFRAGYRRGNAVLRAAQVAVAEPSEDGGDALYEDGPDAGISDRVTEVGPPGEYDA
AEGQPAAGASPGRENAPLPDDTGSVPGPDRGGPTVSAD
Download sequence
Identical sequences A8LDT4
298653.Franean1_0232 gi|158312097|ref|YP_001504605.1| WP_012157676.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]