SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_0578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_0578
Domain Number 1 Region: 118-264
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.45e-23
Family Tetracyclin repressor-like, C-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 49-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000013
Family Tetracyclin repressor-like, N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_0578
Sequence length 267
Comment (Frankia EAN1pec)
Sequence
MTSSPPAVTDSLRSPAHDDGAAPTEETAVPAEPGSARWWAERALVDRRRRPRAGGLSTER
IVETALEILREEGLEALTVRSVAERLGTSNASLYRHIASRDELIALIADHVMGDIRLDRT
GRGWRADVEALMFEMRRVILSQPLPPSAGRSKSGSGSGPNMLRLVEFALALYREAGLTDR
QAVYTTITMIEFVGGSTNIRRSPAGRGSNGVAGAADLRQLLDGLPADDFPALRTAGNLYT
AASADDVFTHGMTLFLDGVASQLPSSQ
Download sequence
Identical sequences A8KXD4
298653.Franean1_0578 gi|158312435|ref|YP_001504943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]