SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_1734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_1734
Domain Number 1 Region: 232-427
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.8e-68
Family B3/B4 domain of PheRS, PheT 0.00000613
Further Details:      
 
Domain Number 2 Region: 506-622,656-756
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00089
Further Details:      
 
Domain Number 3 Region: 34-204
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-28
Family Myf domain 0.0047
Further Details:      
 
Domain Number 4 Region: 767-864
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.92e-23
Family Anticodon-binding domain of PheRS 0.00081
Further Details:      
 
Domain Number 5 Region: 433-514
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_1734
Sequence length 865
Comment (Frankia EAN1pec)
Sequence
MSWLREQVGGLPPAKAVADALIRAGFEVEGLETVGGDLAGVVVGEVLSIEVVAAKKKDVR
FCRVRVAELGEPGGPVASGAEEAEPGVRGIVCGAFNFEVGDRVPVALPGSVLPGGFEISS
RKTYGHVSDGMICSARELGLGEDHSGILVLPAGSRIGTDVAELLGLGDEVLDIAVTPDRG
YGLSVRGIARESATAFGLPFDDPGAWGSDEPAATGAGSATAGSTTGAGDAAGYPVRVEDT
VACDRYVARTVSDVDPAARTPLDWSRRLSLAGMRPISAPVDVTNIIMLGLGQPLHAFDRA
KLTGPIVVRRARAGERLLTLDGVDRELDPEDLVIADDSGPIALAGVMGGAATEISAATTD
IVLESAHFDAVTVARTARRHRLGSEASRRFERGVDPALAPVAAQRAVDLLRELAGATAEP
GVTDVDHRAAPEPIVFPLGEPERLAGRPYPADAIRRRLADVGCLLRDPEPAEAAGSPGEP
GELLVTAPSWRPDLLRPADLVEEVVRLEGYDTIPVTLPLLPAGRGLTAAQQMRRAVGRAL
AADGFVEVLTLPFVAEDAADALGLPAGDERRAAVRVANPIAQDASYLRTTLLSGLIAAAV
RNLGRGQTDLALFESGLVFREPADVPAVPAAVVTPPVDRRPSEDEISALNAALPRQPRHV
AVVLTGLREPAGWWGPGRAADWGDALAAAHAAAAAVGVELAVAAGDAMPWHPGRCAELSV
DGRVVGSAGELHPRVLGSAGLPARTCAMELDLDALIGAALERPPVAAPAISTFPPADRDV
ALVTAVDVSVSAVTEALRAGAGDLLEALSLFDVYEGDQVGPDRRSLAFGLRLRAPDRTLT
AAEANDARDAAVAEATSRTGAVLRG
Download sequence
Identical sequences A8LE37
gi|158313570|ref|YP_001506078.1| 298653.Franean1_1734 WP_020459344.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]