SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_1756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_1756
Domain Number 1 Region: 185-260
Classification Level Classification E-value
Superfamily PKD domain 0.0000000196
Family PKD domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_1756
Sequence length 298
Comment (Frankia EAN1pec)
Sequence
MSHRRGHLAALAALVAAALLALSGAGPGPLSAPGSPAWAAPAPGPETAAQVPCTGARWGS
CDTRATDNGYQYRYRGGYLERVPLGGATGGGGGGCGDDCPPDPDALCALLTGVGPAPEMT
AAERAEYDALVANCGPVLYDPDGIAVADIAAQLADYLREELLPTPDVVIQPVGNSFANLP
TIMHTAVPDAFTFDVAEPVLATISANPHYVWDFGDGETGPDAPGRPYDPAISPRDHPDAY
VAHAYHRPGTYQVTLTVTWDGFFTVPGVAQAFPLADVVLAAAEPITIEEAGGVLVDND
Download sequence
Identical sequences A8LE59
WP_020459366.1.9268 gi|158313592|ref|YP_001506100.1| 298653.Franean1_1756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]