SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_1887 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_1887
Domain Number 1 Region: 88-199
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.96e-16
Family Tetracyclin repressor-like, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000144
Family Tetracyclin repressor-like, N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_1887
Sequence length 202
Comment (Frankia EAN1pec)
Sequence
MGKDVAGKDVVRPSSVRSAQIRAAALDLFTRSGYEATTMADLGAAVGMRGPSLYKHVASK
QDVLEQIMTGTMEALLAAHRTAVATTADPVERLRRATEAHVRYHARHRLEAFVGNREIRS
LTQPNRERVLGLRAEYERCFRDLIEAGLRAGRFQVESARLASYAILDLGMGVAVWFRDDG
ELTEDAVVWQFSQFALRIVGAA
Download sequence
Identical sequences A8LGM5
gi|158313723|ref|YP_001506231.1| WP_020459493.1.9268 298653.Franean1_1887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]