SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_2104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_2104
Domain Number 1 Region: 204-319
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 4.17e-18
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 11-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000505
Family Extended AAA-ATPase domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_2104
Sequence length 333
Comment (Frankia EAN1pec)
Sequence
MLIHVPPPSAPPPLVVVSGDEDLLVARAVREVLDAARARDPEVEVVDRSPGELTEADMID
LGATSMFGGGRVLVVRGAADLAEELRDALLAYVAHPLDDVVLVVVHSGVVKNRKLVDAMK
KAGARVMPAAKITRPRDRHDFVIAEIRRLGGRMTDEAVRALLDAVGGDLREIAAVCDQLV
ADTAGVIDESAVARYHRGRAEASGFAVADAAVAGDLAGALTLLRQALEGGTAPVLVTSAI
AGGLRDLARVSAVGGGSKWDVAKALGMPDWKVERAQRAARSWSDAGLARAIRAVAVADAG
VKGAAVDAGYALERLLHEVTQARGRGEYAGRAR
Download sequence
Identical sequences A8KYV4
gi|158313938|ref|YP_001506446.1| 298653.Franean1_2104 WP_020459706.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]