SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_3419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_3419
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000134
Family Homeodomain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_3419
Sequence length 211
Comment (Frankia EAN1pec)
Sequence
MREIAEKAGASKPTVRLWLSRYDEEGPDGLVSRVSPGRPREVPGRVRARILALTRTTPPP
ETGLSHWTSTEMARYLKRREGVSVSHTFVAQLWRENNLQPHRHRVFKLSADPDFEAKVKD
AVGLYLDPPEGAEVLSIDEKPGVQALDRTQPPRPVASGRVATRTHDYQRKGTTDLFAALD
VGTGRVTARCFPSHTRADFLTFMDPRLSHFP
Download sequence
Identical sequences A8KXN7
gi|158315219|ref|YP_001507727.1| 298653.Franean1_3419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]