SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_4504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_4504
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily Homeodomain-like 6.48e-18
Family Tetracyclin repressor-like, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 77-196
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000125
Family Tetracyclin repressor-like, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_4504
Sequence length 216
Comment (Frankia EAN1pec)
Sequence
MRSDSVRNRAAIIEAATAEFTARGQGADVREIASRAEVALGTLYRHFPTKDELLETVMQD
LFTTWQNTALTGWMNHPDPWEALTGFIDDAVCRQAVHVALTERLARPFSERQLDECARRL
AAVAEHLVARCHRAGLLREGVVGEDIIQFVICLASLADHSTIPVITTTPAGQASPPRPTA
TPWARQRQIGLDGLRPAHGVLTPTRTQYQDHSNSHI
Download sequence
Identical sequences A8LBY1
298653.Franean1_4504 gi|158316277|ref|YP_001508785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]