SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_5224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_5224
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000616
Family Tetracyclin repressor-like, N-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_5224
Sequence length 207
Comment (Frankia EAN1pec)
Sequence
MTRTYQQRRRAESADANTERILAAGAELFGERPFDQITLAAVAERAEVGVQTVIRRVGTK
DGLVRAVNAWLVPQIEGARGEPDVSDPAVVAERLARQYERWGQVTDRAIRQQDVSPALAE
AAAAGRQAHRAWTAAAFAAELDRRPPADRHDLLGRLTAVCGVELWLVLRNDEGLSVEATR
AAVADLIAACLGGPGSSLAGPDSSTTP
Download sequence
Identical sequences A8L0P9
gi|158316980|ref|YP_001509488.1| 298653.Franean1_5224 WP_020462695.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]