SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_6103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_6103
Domain Number 1 Region: 15-190
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.33e-43
Family PAPS reductase-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_6103
Sequence length 223
Comment (Frankia EAN1pec)
Sequence
MDAALKARALRAGDELEGAPAEEILQWAADEFGTGLVVAASMAEAVLVDMLARIRSDVPV
VFIDTGYHFAETIGTRDAVAHTYSLPIISARPQLTVVGQDAVHGPRLYESDPDLCCRMRK
IVPLDRALAPYRAWAAGSRRVESAGRKSLPVVGWDQRRGKVKIHPLATWTDEDVERYVQE
HNVIVNPLLSDGYESVGCWPCTQRGAGRDGRWAGTTKTECGIH
Download sequence
Identical sequences A0A1S1PHB9 A8LCB0
298653.Franean1_6103 WP_020463528.1.13248 WP_020463528.1.9268 gi|158317845|ref|YP_001510353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]