SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_6608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_6608
Domain Number 1 Region: 262-312
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000296
Family AraC type transcriptional activator 0.0051
Further Details:      
 
Domain Number 2 Region: 210-259
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000493
Family FIS-like 0.068
Further Details:      
 
Weak hits

Sequence:  298653.Franean1_6608
Domain Number - Region: 35-103,133-185
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.011
Family Regulatory protein AraC 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_6608
Sequence length 330
Comment (Frankia EAN1pec)
Sequence
MDVLSDAVTMLRTGRPHSNSNRLWAPWGIRFPPTDGAGFHIVLMGTCWLLRAGARPLRLA
AGDIVLLPREPGHALADDPASPLTDFRADPHGPIPSEHADGYGGSGPGGRTVTELLCGAY
MFDRFRLHPLLADLPDVIHLPARVGHHPRLRAAVDLLGAELAEPRAGAAASMSALLDLLL
LYMLRAWFDDHSTGSSTGSSTGWSAALADPAVSAALRAMHAEPEMPWTVRELGARVGLSR
TVFAQRFTALVGKPPLAYLTWWRMTMAARLLRETDSPLPAVARRCGYSSEFAFAKTFKRE
FGVPPGAFRREGRPPSGSPADASPLTATLS
Download sequence
Identical sequences A8KZG5
298653.Franean1_6608 gi|158318343|ref|YP_001510851.1| WP_020464016.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]