SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_7044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_7044
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Homeodomain-like 3.05e-19
Family Cgl2762-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_7044
Sequence length 98
Comment (Frankia EAN1pec)
Sequence
MESRRRFDREFKEGAVRIVLETEKPVAAVARDLGVHEATLGNWVNAARRREKKGELSEDE
RVELERLRAENARLTMERDVLKRSVALWVNEAMGRTAR
Download sequence
Identical sequences A8L4X6
WP_020464441.1.9268 2005205847 gi|158318773|ref|YP_001511281.1| 298653.Franean1_7044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]