SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI153974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI153974
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Ribosomal protein L1 0.0000000000196
Family Ribosomal protein L1 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI153974
Sequence length 130
Comment (Laccaria bicolor)
Sequence
DRNKELVKKLAKEYDTFLASETLMKQIPQLFSLGLSQILSFSPFILANKIMEVRSTIKFX
SSRKLCAWTTIGCLGSQQHHTEYVSSFCHLGYMLTMLLGINFLVSLLKKNYWIIKLLHIK
TTMGDPVHHY
Download sequence
Identical sequences jgi|Lacbi1|153974|gww1.5.665.1 29883.JGI153974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]