SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI230477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI230477
Domain Number 1 Region: 30-241
Classification Level Classification E-value
Superfamily Ribosomal protein L1 9.03e-40
Family Ribosomal protein L1 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI230477
Sequence length 321
Comment (Laccaria bicolor)
Sequence
MAKDELIDSKVSLKQCRLAVEALHSHESKRLEKLQETELLPGKEQNIWLNVTVKKIPSGH
KFKPIKIPIIHPLVDPRTTPVCLITKDPQRQYKDLLESHEIKFISRVVGVEKLKGKFKPF
EARRALLKENGLFLADERVIPLLPKLLGTKWFEAKKQPIPVCLTRKDLKGELERAISSTY
MNQNQGTCTSIKVSSLSHKPAQVLANIQSAIPAVVKHIKGGWDNVQSFNIKTNSSVSLPI
WSCRLDGEEGGRWDGFAAEDEQSDDEDKEKDSGEEEEMEVDDDSTKTKKGAKKSGLKRAT
SSDEEEEEEKPRKKSKGVKGT
Download sequence
Identical sequences B0CX82
29883.JGI230477 jgi|Lacbi1|230477|e_gwh1.3.611.1 XP_001876125.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]