SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI326420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI326420
Domain Number - Region: 811-839
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00133
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI326420
Sequence length 918
Comment (Laccaria bicolor)
Sequence
MIVHSQRTRGLQEVVTAARAIFTGTSPYLTSLRVTTPLTLGTSRLPIPTSTRPSSSKTSV
PEVPTPETTWRKGPTLALTLQAPIGSKETPVMRDPPPHQPLPSGPSGSASPTITPISNES
VPTTSLSAVEPTVDPALNSSLNRQGMERGYSLSPMYSLILEYNREQGDNLSTAAEVSWIL
QKPILKPQDIEKGGDDSDPYTAYRQSEVPLSPLSTVPELYDEIDNIDSVDDRMRFMLDNV
PRHQNQILSGAREALRDGLGWDVICPTPPLPSAAISQPSTSEFSRTRIAQGKKKVDWDDS
APWENTSTSVEQGRNLDEGLEPSFGFQTPFKKGTHFFDTTTEGLSPAFFSMPGLGSATDV
TVGLATPSRTELSENVREYSANQGTNALTITKRIPDSTQAATTAPTSSSSFKNVNPFASN
GYNGSPQVPPNGGGGNGGGGGNSPQRGGGNGLPHSGGGGGGDPGRGPHNPGGGGGPSNNL
PPRTPQFYSNPGGGSGGGGGGDPGGGGGPSPQNNDSWPPAPYGNMPASIKTELKVEQLPE
WDGNHWTAIDYFWQIQQLAYLGGWLPEALGYWLWFHLKDSSPVRRWFVTLPLAHQSYMRS
HYLRFLKGIKDGFLGHCWQLKMNNYYNAQTFRERNHERELPSEFIIRRIIYTRMLLSVDA
GGPLEVFYIMRKAPVSWGPILLLSSIKDSSELYSRVTEHEEALLEAYRVSRGGQTPSIDN
IVTQLKQMGFVQERQSHQRRANMVEYSASTDFMPVPSTDDVVSASSTAVEDLSSGQYILR
EAYQVLRQRPRLPPKGGYPFSKNDHITTKMGKMPPSPCKCCGSANHWDKECPDWNTYLER
AKRSANSVEIWPEDEADKAYASAYSVLLNERLTDQSTNQPVPLESPIQQGFEQASSTSQT
PAEEANGLLWKKWKTRIT
Download sequence
Identical sequences jgi|Lacbi1|326420|fgenesh3_pg.C_scaffold_10000091 29883.JGI326420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]