SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_0995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309798.COPRO5265_0995
Domain Number 1 Region: 75-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-25
Family Translational machinery components 0.00027
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.36e-22
Family Ribosomal S5 protein, N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_0995
Sequence length 162
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MDMTNLQERVIEIRRVARVVKGGKRLRFRALVVVGDGEGHVGVGIGKAGEVPDAVAKAVT
RARKNMIEVPLAGTTVPHTVTAKAETATVLIKPAVKGTGVLAGQTVRAILEMAGIKDVIT
KSMGSTNPVNLAYATMEALKSLKRPREVAELRGVSIEQILKR
Download sequence
Identical sequences B5Y970
309798.COPRO5265_0995 WP_012543719.1.90209 gi|206895372|ref|YP_002247317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]