SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_1285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309798.COPRO5265_1285
Domain Number 1 Region: 571-718
Classification Level Classification E-value
Superfamily TPR-like 0.000000000617
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Weak hits

Sequence:  309798.COPRO5265_1285
Domain Number - Region: 148-199
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.000562
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_1285
Sequence length 739
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MAKKSQRRTSEGPTPLLLVTLSLILLVFPLVFYSRAVTRAFDLTKSAVFTWLWLVLGSWI
LFLSLWKDQKWLKTPLLIPIIGYALSLVFSTVFSITPIISFLGVYERQIGLIVQLQAISL
AFILAGVVDRKNLLNIVVDTLIVFGTVNALVGMSQFFGFDPLGFTSGYGTEAFGFMGNPD
FFGPVMVITTFLTFGRLLSDLGSDNTWIWLTSFALQFFSLMVTAQGGVMGAFGGLTMGFL
TFHTFFTGDDKKKNEKWLYAPLGVALALFVLTLLVFPANRMTDLLSAVLGIGVGLTLWAF
INLVFLDRREHAKLWRFSAILVVVVLAVGIFGVYEIYSLPPVTIAEKLGFTVGTRLVLWK
HTIGFSIENTLDGKLFGIGIESFRRGFMPYKPLELSQLEPNVNYDDPHNNFLGVLAKVGI
IGFVFYAWIFIAAAGMLYKTLRVAEPKKEKMLIIGIAAALVAYATNLVTIFDMLPSLMMF
YALLGLIMASYNIYVRPTEEIKQTKPWVKPTTLVAWALLLGLSLYNGYYYFNAWKAESYF
RSGLGNMRYYESNQASLTDEQKPQVIASSLYFLDKAMAYNPNESYYAINYLRAASYYWDL
TQTASPDEANNVVATAIAKAQQYESTTWAPENLYATMANVYAKVGGLDKSIEYFEKAVNW
DHQFYSARMNLAILLSNRAQLYLAQGNKDAARTDLNTALEHIKHAQEVLAITTNEELVKM
RDQMASIQKSIESLLASIE
Download sequence
Identical sequences B5Y9Z0
WP_012544459.1.90209 gi|206896112|ref|YP_002247587.1| 309798.COPRO5265_1285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]