SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309799.DICTH_1571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309799.DICTH_1571
Domain Number 1 Region: 189-441
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-66
Family Pyruvate oxidase and decarboxylase Pyr module 0.037
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0072
Further Details:      
 
Domain Number 3 Region: 452-557
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000107
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309799.DICTH_1571
Sequence length 559
Comment (Dictyoglomus thermophilum H 6 12)
Sequence
MECKILIGGEAGQGIQTISNILSKYFFRIGYYVFTIESYQSRIRGGHNYSLLRISDKPIY
AIDNEKVDILIALNLETIRLHLNEVKEGGHIFCDESIKTEEFLGDDRIIKIPVKQITQEL
KSKLVENTIFVGALLALSSGDIDEMRKIIAETFKQEYFDINMRALEEGYKYARDLNRSCG
SFLKRGRDNRLLLNGAEAVGFGAMVSGCKFLASYPMTPGTAVMNFIAEHELDFDVVVEQA
EDEIAAINMAIGAFFAGARSMVTTSGGGFALMVEGLSLAGMTETPVVIHIGQRPGPATGL
PTRTEQGDLNFVVHAGHGEFVRYVTAPRDQKDAFYKTIKAFELAEKYQIPSIILTDQYLI
DSKAVIEELNPPSEIKFYRVKADTNYLRHKITEDGVSPFAIPGESEALVITDSDEHDEEG
HITEDLSIRKRMVEKRMKKLNLLLKEIEEPSYFGVENPEIIFIGWGSTYGVIKEGIERLI
REGYPIGHLHFSDVYPIVNEHLEKYKGIKLYTIEQNYQGQFAALLRKETGVDVKRGLVKY
NGFPFYVEEIIKGVKELMG
Download sequence
Identical sequences B5YAB6
309799.DICTH_1571 WP_012546964.1.10127 gi|206900171|ref|YP_002251386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]