SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_0459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_0459
Domain Number 1 Region: 75-310
Classification Level Classification E-value
Superfamily PRTase-like 2.67e-39
Family Phosphoribosylpyrophosphate synthetase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_0459
Sequence length 325
Comment (Salinibacter ruber DSM 13855)
Sequence
MPDDLRLFALSESRGFGEAIASALDTELDAHHERTFTDGEHEVRPEVNVRGRDVFVVQSL
YADDTWSVNDKLCRLLFMLGALRDASAERVTAVIPYLCYQRKDRKTRPRGPVTTRYVAGL
FEAVGVDRVLTMDVHNLAVLQNAFQARTEHLLGHPLFVHRLTDVVGAEEVAVVSPDEGGV
KRAGKFAEGLGAVLNCEVPTAFVEKMRKDDGVTGGALVGSVEDRTAIVVDDMVSTAGTMT
QAIRSCAEEGAESVYAVATHGLFVGEADERLETAPLDALFVTNTVAPRLTGAAAERLQIC
NAAPRFAAAIQAVHTETSVSALNEV
Download sequence
Identical sequences D5H601 Q2S5C7
gi|83815558|ref|YP_444604.1| 309807.SRU_0459 gi|294506350|ref|YP_003570408.1| WP_011403237.1.91540 YP_444604.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]