SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_1602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_1602
Domain Number 1 Region: 222-409
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.57e-32
Family Peptidoglycan hydrolase LytM 0.0086
Further Details:      
 
Domain Number 2 Region: 38-123
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000209
Family Tropomyosin 0.0041
Further Details:      
 
Weak hits

Sequence:  309807.SRU_1602
Domain Number - Region: 160-250
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0209
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_1602
Sequence length 412
Comment (Salinibacter ruber DSM 13855)
Sequence
MRSPWPPRQIAQWAVRAGLVVLLALAGPVAPPAAHGQDASSRRETTEQRLDQLQQQIQQE
QQRLQKTEKEAESTQEQLESLQREIALREKLVSTYQARLDELGRERSRLRDTLSTLQTRL
ETLRKDYRDQLVHAYKYGRLHDLALLLASRSINQMLIRARYLRRFATDRRRQRSAIQTAA
GEVRSSREQLAEKRAETRDLLAEARTERTNLRALERERRQVIDELRARRSELEQQIEQKQ
RQAQQLEQRIQKLVARAKREQADSGMEAEVAANLSASFQANRGALPWPVEGAVTTDFGNQ
VDPVHETTTYHPGILIATSPRSPVRAIFDGTVTGIDFVPGYGTYVVIQHGEYLSVYSNFS
TLSIAEGNQIEAGQVIGQSGTESEPRGASLFFGLVNRSSSEFVDPSGWLSVR
Download sequence
Identical sequences D5H9L8 Q2S258
gi|294507617|ref|YP_003571675.1| WP_011404349.1.91540 YP_445723.1.20240 gi|83816850|ref|YP_445723.1| 309807.SRU_1602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]