SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312153.Pnuc_0126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312153.Pnuc_0126
Domain Number 1 Region: 21-293
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.35e-94
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000028
Further Details:      
 
Domain Number 2 Region: 294-316,363-452
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.7e-22
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312153.Pnuc_0126
Sequence length 466
Comment (Polynucleobacter necessarius asymbioticus QLW P1DMWA 1)
Sequence
MAFHEKEVPADASAAQKLMAWVDSRLPVTDAFKRHMSEYYAPKNLNFFYIFGALAIVVLA
LQIITGIFLVMNYKPDAAKAFDSVEYIMREVPWGWLIRYMHSTGASMFFVVVYMHMFRGL
IYGSYRKPRELIWIFGCAIFLCLMGEAFFGYLLPWGQMSYWGAQVIVNLFSAIPLIGPDL
SLWLRGDYVVGDATLNRFFAFHVIAIPLVLIGLVAAHILALHEVGSNNPDGVEIKDNLDA
QGHPVDGIPFHPYYSVHDVMYLGGFLMVFACIVFFAPEMGGYFLEANNFIPANPLQTPLH
IAPVWYFTPFYSMLRATTTNFLLPLWIFLAVILGMFALKTKDMKVKGACAAIALILAVGF
YLFDAKFWGVVIMGGSVVIMFFLPWLDHSPVKSIRYRPQFHKYIYGIFVVCFVILGYLGI
QPPSPVFEKISQICTIYYLGFFLGMPFWSTLGTFKPVPTRVTFKSH
Download sequence
Identical sequences A4SV33
312153.Pnuc_0126 gi|145588314|ref|YP_001154911.1| WP_011901972.1.22821 WP_011901972.1.27397 WP_011901972.1.31131 WP_011901972.1.54276 WP_011901972.1.58031 WP_011901972.1.63010 WP_011901972.1.78143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]