SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312309.VF_0321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_0321
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-59
Family G proteins 0.0000000939
Further Details:      
 
Domain Number 2 Region: 333-435
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.16e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 243-328
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-24
Family Elongation factors 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_0321
Sequence length 478
Comment (Vibrio fischeri ES114)
Sequence
MNSAVEQQLAELGIEAYLKEHQYKSLLRFLTCGSVDDGKSTLIGRLLHDSKQIYADQLDA
VHADSQRVGTTGERPDLALLVDGLQAEREQGITIDVAYRYFSTQKRKFIIADTPGHEQYT
RNMATGASTCNVAVILIDARKGVLDQTRRHSYIANLLGIRHFVVAVNKMDLVEYSQSRFE
EIKEEYLAFSKKLNNPNLDISILPLSALEGDNVVNPSDALSWYQGEPLLEVLENVDIDAD
KGNGEFRFPVQYVNRPNLDFRGFAGTVSSGGISVGDEIVALPSGKKSKVARIVTFDGDLT
SAQAGQAVTLTLEDEIDISRGDLLVKSQSNLQATDQFKAEIVWMTEKGLEPGRQYDIKIA
GKKTVGQIDAIHHQVNINSLEKFDTQELPLNGIGLCDVSLTETVSLDRYQDCADTGGFIF
IDRLTNVTVGAGMIQNLSDLSESKPINDNISAFEIELNALIRKHFPHWETKDISKLLG
Download sequence
Identical sequences Q5E830
WP_011261125.1.76652 YP_203704.1.56684 gi|59710928|ref|YP_203704.1| 312309.VF_0321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]