SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312309.VF_0555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_0555
Domain Number 1 Region: 63-274
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 7.46e-55
Family Peptidoglycan hydrolase LytM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_0555
Sequence length 337
Comment (Vibrio fischeri ES114)
Sequence
MPDKIRISVSHNKGTRLFAISQRRKKLVILSLVLGVSSFALSGFGLHYFYQQQESAKVAI
AELQNKNNVLNQLIVDNNNSNHELTQQLEAKENELLVISQRVDDVESVLGLQEISEEDSS
LAEKTLEQRLDVAAIDSAVRATMFRLIPNDTPLHYTRESSSFGRRTNPISGKRQRHLGVD
LTCKRGTEIYAPADGVVELARASNKGYGNLLKVQHSFGFMTMYAHLQKFKVRSGQFVKKG
ELIATCGNSGNSTGPHLHYEVRFLGRVLNPRSFMDWTPEKFDSLFEKERSVKWTPLVDVI
NNVVKLQLKLTQKPTVEQVEAINTAKAENESSQQLTQ
Download sequence
Identical sequences Q5E7E6
WP_011261315.1.76652 YP_203938.1.56684 gi|59711162|ref|YP_203938.1| 312309.VF_0555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]