SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312309.VF_1158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_1158
Domain Number 1 Region: 66-183
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.53e-34
Family Muramoyl-pentapeptide carboxypeptidase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_1158
Sequence length 183
Comment (Vibrio fischeri ES114)
Sequence
MSEFSPLRRKILLGGAATAGLSLFPSFSFASQFAETPRKLALSNLHTGEELKTEYFNGRQ
YQSAELHKLNHLCRDFRRNESIEMDKRLFDQLSAIQNVIGCDTQVQIISGYRSPATNEML
RGKSHGGVAKKSLHMLGKAMDFRLEGVPLAEVRKAALSLKAGGVGYYPGSNFVHIDTGRV
RFW
Download sequence
Identical sequences Q5E5P3
312309.VF_1158 APC64205 gi|59711765|ref|YP_204541.1| WP_005418984.1.23113 WP_005418984.1.62330 WP_005418984.1.76652 YP_204541.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]