SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312309.VF_A0406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_A0406
Domain Number 1 Region: 2-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.51e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_A0406
Sequence length 216
Comment (Vibrio fischeri ES114)
Sequence
MKIWDSFVRIYHWSQVVVLGSLWYTAEEGLMELHFTLAYLLMALLLTRILWGFIGSDTAR
FSHFLGSPQSVINYLKTSHTNGLHHSKGHNPAGGYMVLALLLLLLVQLVTGLFSNDDILS
EGPLAYLVSYDKSGFLTRIHHLNFDLILGFTAVHVIAVILYRLKGVNLILPMFTGKVDLD
ETEPKMKHPFKAWIIFAVISVFIYFIWADEVISYLF
Download sequence
Identical sequences Q5E0H0
312309.VF_A0406 gi|59713589|ref|YP_206364.1| WP_011263283.1.76652 YP_206364.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]