SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE27957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE27957
Domain Number - Region: 70-94
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0023
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE27957
Sequence length 211
Comment (Caenorhabditis remanei)
Sequence
MPFVLKFGSVSSATSTSSTDRSSRSEDVGGDSGKKPSLAALAQSAFPSRYDPNAFVDISG
ATIAAPTITGACKRCGYPGHLYFQCRNHIEVRPNQSTKAYEVSSTSSESSDEEDTPLIAL
EKERKRAKKLKKKERREKKKVKKMEKKEKKERKRSRKDSDDSDSDSEEERKKKKRSKKSK
KEKKKRRHSDSDDSDSDDGDRHRDSKRRRRD
Download sequence
Identical sequences E3NQJ1
CRE27957 XP_003089330.1.11157 31234.CRE27957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]