SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314315.LSA0689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314315.LSA0689
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Formyltransferase 6.67e-62
Family Formyltransferase 0.0000054
Further Details:      
 
Domain Number 2 Region: 205-307
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.41e-29
Family Post formyltransferase domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314315.LSA0689
Sequence length 318
Comment (Lactobacillus sakei 23K)
Sequence
MTSIVFMGTPQFSVPILEALVANDYQILAVVTQPDRKVGRKQVLQQTPVKEAAVRLDLPV
FQPEKLSGSPELADVIALQPDLIVTAAYGQFLPTKLLEAAKIAAINVHGSLLPKYRGGAP
IQYAVLNGDSEIGITIMHMAKKMDAGDMIEQASIPIEATDDTGSLFDKLSYVGRDLLLKT
LPGIIAQTAPRTPQDEVQVTFAYNITKEQEQLDINQPAEQLLNQIRALRPQPGAWLAVNG
QRTKIWQATVAETTTDQAAGVVVALNKKDFELAAGNGTVLKITEIQPAGKAKMPVQSYLN
GVGKQLAVGQQVVVQDAE
Download sequence
Identical sequences A0A2H1M3Z6 Q38XT6
314315.LSA0689 WP_011374398.1.13714 WP_011374398.1.42590 gi|81428304|ref|YP_395304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]