SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_2228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_2228
Domain Number 1 Region: 68-195
Classification Level Classification E-value
Superfamily RmlC-like cupins 3.71e-22
Family TM1287-like 0.059
Further Details:      
 
Domain Number 2 Region: 11-80
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.24e-18
Family SinR domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_2228
Sequence length 197
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MYYDGRKEVVTMIHYRLGQTVLSYRKKNNMTIREFADYAGISTSLISQIERGHANPSLNV
LELIAKALNVPLFTLFINDIDTDSLISKKKDRKKVYRENNDHIVYDVLTPDFMKARIEML
MMDLNGYANTTESHYSHEDKEEIAVVMKGEVYVELEGNEYFLEEGDVVRIPPNVKHRFLN
KSDEMNHILFVLTPSLS
Download sequence
Identical sequences A0A1W6A8D0 A9VF72 C2XU04
gi|163940192|ref|YP_001645076.1| WP_002065351.1.45835 WP_002065351.1.76817 315730.BcerKBAB4_2228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]