SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_2967 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_2967
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.61e-20
Family DNA-binding N-terminal domain of transcription activators 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_2967
Sequence length 264
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MYTIGQVAKFLDVSRDTLKFYEEKGLVKPKQNIENGYRKYNHFDIYDITTVNFYREMDIE
IKKIQELRKSKSIEGIKSLLEEKEKEVLKEIEYKKLLLKKLQIVKEDCEKTKQFLGEYVV
KEMKPLEVNGEIEHFTAYDEFESLKKNTDSLKKAVTLTSLRRVINFNEEGIIEDKFIIVR
KVEDFDKDLEGEILSHPKCIYTVIEDGRWATGGESIDHNVESSLRKAAIEQGYELLGLVY
INILLTTYEDELERIFLEIYAPVK
Download sequence
Identical sequences A9VL52
gi|163940897|ref|YP_001645781.1| 315730.BcerKBAB4_2967 WP_012261242.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]