SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_3051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_3051
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.51e-17
Family Phage repressors 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_3051
Sequence length 242
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MREIHIHKIIADKRKEKGITQEELAAYIGITKASVSKWETGQSYPDITFVPLLASYFNIS
IDELICYTLQMEQEDIKNLYHRLAEAFSEEPFDEVMMECREVTKKYYSCFPLLIQMGLLF
INHHMLTEDMDRRIEILEEAMYLFSRVQGESVDVSLVKEAVSFKATCYLILNRPNEVLQL
LGETIRPNFPEEDLIAQAYQMFGNAEKANEMMQISMYQHLIQLVATIPNYVVVHASNAEK
VE
Download sequence
Identical sequences A9VLW5
WP_012261285.1.99908 gi|163940975|ref|YP_001645859.1| 315730.BcerKBAB4_3051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]