SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_3437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  315730.BcerKBAB4_3437
Domain Number - Region: 18-66
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00128
Family Terminase gpNU1 subunit domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_3437
Sequence length 81
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MYKFEDKEQLLSFLHDEVLTTPEVMDVLGISKARISKMIKDGKLEPFKKMERVSLFLRED
VEEKKKELEALRIKYRPYESK
Download sequence
Identical sequences A9VQW1
gi|163941354|ref|YP_001646238.1| 315730.BcerKBAB4_3437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]