SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_3596 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_3596
Domain Number 1 Region: 54-117
Classification Level Classification E-value
Superfamily MtlR-like 0.0000034
Family MtlR-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_3596
Sequence length 152
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MSVNSLVAKFSENIKNEEPLYVFLKTHLCVESIMIQILEKNVPNPKAIKFDNFNFAQKMQ
LVHALNIIGDDMREAYNKFNRVRNDLAHYHNQEIDGEVIEKLYNTLPKDKKSFAYEFCLG
NPDIIGTLRGFCTLLVVYLVSKGDYIVYKVSE
Download sequence
Identical sequences A9VS67
315730.BcerKBAB4_3596 gi|163941511|ref|YP_001646395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]