SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_5127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_5127
Domain Number 1 Region: 8-351
Classification Level Classification E-value
Superfamily Release factor 4.84e-133
Family Release factor 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_5127
Sequence length 355
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MLDRLQAVENRYEKLNELLSDPEVISDTNKLREYSKEQSDIQDTVEVYREYKDVREQLRD
AKAMLEDKLDADMRDMVKEEVSELEGQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGG
DEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGA
HRVQRVPETESGGRIHTSTATVAVLPEAEEVEINIHEKDVRVDTFASSGPGGQSVNTTMS
AVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGD
RSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQKMEAAE
Download sequence
Identical sequences A0A150CHJ9 A0A1W6AHP0 A9VSC7 J8BVF6 J9BF98 R8CNB4 R8CU35 R8HJN1
gi|163943017|ref|YP_001647901.1| 315730.BcerKBAB4_5127 WP_002139009.1.100649 WP_002139009.1.17940 WP_002139009.1.39317 WP_002139009.1.45835 WP_002139009.1.54007 WP_002139009.1.68668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]