SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_2799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_2799
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.41e-23
Family Voltage-gated potassium channels 0.00087
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.87e-16
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  315750.BPUM_2799
Domain Number - Region: 287-326
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0222
Family TrkA C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_2799
Sequence length 328
Comment (Bacillus pumilus SAFR-032)
Sequence
MKSNRIFIAWLRWPLYLRIAVIICFLLLFFGQLIVILEPKQYHTIFDGIWWALITVATVG
YGDFVPQTMPGQIAGMALILIGASFVTAYFATLAAAVFSKQHHYVEGKVAFKGKGHLIII
GWNEKTNKLLQSFQTIDPAMPIVLIDDSLKEGPLLENVHFIKGHGTEDGTLRKANISGAD
ALMITADQHENEVTADMQSVLTLLAAKGLNPSLYCLIEILTDRYVKNAERAGANQVIHTS
DAVNHLMVEHFLLKEQFKALQKKRHMTLHKQVTIIPVPASLTGETFLTALHHFLEHHVIV
VGIQKKEGPMLNPPFDYELHPEDELISL
Download sequence
Identical sequences A8FGT7
315750.BPUM_2799 gi|157693552|ref|YP_001488014.1| WP_012011077.1.28396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]