SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3649
Domain Number 1 Region: 256-360
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.0086
Further Details:      
 
Weak hits

Sequence:  316274.Haur_3649
Domain Number - Region: 197-254
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00834
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3649
Sequence length 361
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MQSTRIVDPDQLPDHLRLGRYLGLTAIAIYLGLFTGAGLTVMIPDASDFIMQSKIPLSGF
AVLIQGLFFIAARFFARRNEINRSIYLMMLGCTLLPMIITFFNPIEWPLSVLYVFLMLII
AVQFVNSYNLKRISIVAWLSIIIILFFGFIFNDQYNYPKINVLLIMITSGAPIVTMIISI
LFSFHRRLNLTLREVKRINYSLEESRDSLEQQVEQRTQQLQQTLGELQQRNQEQAAYVAQ
IEQQRQTIRELSVPVLPVSRDTLVLPIVGTVENERLRDLQAIALGEIQRRRAQRLLLDVT
GLSWFDNDVAAGLLRLIDAAQLLGAKVALIGVRPEVAQALVNLGIVFDNVAIYRDLQSAL
N
Download sequence
Identical sequences A9B674
316274.Haur_3649 gi|159900166|ref|YP_001546413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]