SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_4139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_4139
Domain Number 1 Region: 8-392
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.46e-130
Family ArgJ-like 0.000000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_4139
Sequence length 395
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MSIFRFAAGFRSAAGRCGLKASGNPDLSLLVADNVCTGAGVFTTSLVKAAPVLYDQAVLA
EHASEIRAIIANAGCANACTGAQGDAAAREMARLAAEAVGCEPHQVLVLSTGVIGHQLNV
EKVAKGVAAIAPELGVEHAPALSEAIMTTDTRPKTSSATAVIDGVEVTVAGVAKGAGMIH
PMMATMLSIVTTDAAIDADLAQSLLREVTDASFNCVTVDGDPSTNDTLLLLASGVSGVTI
NASNIAAFRQALEIVCIDLAKQIAADGEGATKLITITVDHAPSVAAARTVARKIACSPLV
KTAIHGGDPNWGRILAAAGVAGVPFDPSHVELWLGEVQLVAGGTPTNYNEREAASQIGGQ
QVAIRLNLGAGAATGYAWTCDFSAEYVRINADYRT
Download sequence
Identical sequences A9AWL2
316274.Haur_4139 gi|159900652|ref|YP_001546899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]