SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_4325 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_4325
Domain Number 1 Region: 241-349
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000126
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 
Weak hits

Sequence:  316274.Haur_4325
Domain Number - Region: 42-180
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0327
Family LacY-like proton/sugar symporter 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_4325
Sequence length 359
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MAELDNDRLQQQRFARIVRGSLIFLLAFICYDIGLQILAPKPARYLHLVNLIGLLGFLTA
SYLVNQRGRTPQAMLLVATAMLGSSLMMALSNPFALPVILMMPILALILAMLYLEQKMAR
VLSVVAWLCMLLATILAYNVNLFNQAVMPSMEISDFVGLAVLAGIAFLVLNLFQSRLRNN
FLKATQAQKELLQAQSVMEQQIIERTSTLSQLQQTNAEQTRLLAEVEHQRLIIRNLSVPI
LPIDQRTLVLPLVGSLDQQRLDDVRNQALQTISQFKARYLVLDITGVPLIDDQIALSLVR
IIEALKLLGAKTILVGVRPDVAASLASGNLQLGSVTSAATLQEGLDYARTQSKALAKIA
Download sequence
Identical sequences A9AY75
gi|159900838|ref|YP_001547085.1| 316274.Haur_4325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]