SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_3366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_3366
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000155
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_3366
Sequence length 107
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MITFNQQDQRCIVSGRLTQDEVKQLWPKRHELFTASTQVVDLSALEYVDSAGVALLLAFI
KLHASSSQETSVSRQLVNPSEQLKKMIELYDLDAFFQPNIVSNSKGN
Download sequence
Identical sequences A0A2I0H6T9 Q07XR2
gi|114564527|ref|YP_752041.1| 318167.Sfri_3366 WP_011638803.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]