SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_2331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_2331
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.39e-28
Family Sfri0576-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_2331
Sequence length 125
Comment (Shewanella putrefaciens CN-32)
Sequence
MLTISSSDADNIITVIASGWINHLDIESQLLPSIEAKLQDHATIRLWYEFSPEFEGISVG
ALWDDAMLSLFHLSDFSRVVMIADMEKLDAMVNALAFMLPCPVKIFAMNERDRARVWLDE
VVAIE
Download sequence
Identical sequences A4Y7W9 E6XPP9
319224.Sputcn32_2331 gi|146293427|ref|YP_001183851.1| gi|386314105|ref|YP_006010270.1| WP_011919468.1.82224 WP_011919468.1.85280 WP_011919468.1.98421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]