SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_3346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_3346
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-21
Family Sfri0576-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_3346
Sequence length 121
Comment (Shewanella putrefaciens CN-32)
Sequence
MLCQIPDIAKGVISLFASGRLSSTDYRTRLQPAIKSYRKDWGQVCLYIEADVLLEGWEFE
SLTGSGEVQLPNFEALVFVGGPDWVGNALRLLGPFMQGEVAWFPLEQKAKAIAWITKRSN
N
Download sequence
Identical sequences A4YAS5 E6XP60
gi|386315161|ref|YP_006011326.1| gi|120597426|ref|YP_962000.1| gi|146294433|ref|YP_001184857.1| WP_011787978.1.65999 WP_011787978.1.82224 WP_011787978.1.85280 WP_011787978.1.98421 319224.Sputcn32_3346 351745.Sputw3181_0595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]