SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31964.CMS_2183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31964.CMS_2183
Domain Number 1 Region: 5-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-34
Family MarR-like transcriptional regulators 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31964.CMS_2183
Sequence length 153
Comment (Clavibacter michiganensis sepedonicus)
Sequence
MSTPQDLQDPLALDRQVSYSLVVAARSVTALYRPILDPLGLTHPQYLVLLALWARGPRSV
KDLSHELQLDSATLSPLLKRLEAMGHVWRVRRATDERVLEIGLTDQGRELREKAVAIPQQ
IRDRLSMTEEQLEGLKTVLSQVIDNAKALPETI
Download sequence
Identical sequences A0A1Y3FMC0 A0A251Y6C8 A5CV14 B0RFQ7 M5BBL6
gi|473834766|ref|YP_007687064.1| gi|170782531|ref|YP_001710864.1| WP_012039555.1.100120 WP_012039555.1.11755 WP_012039555.1.12855 WP_012039555.1.13751 WP_012039555.1.31775 WP_012039555.1.33835 WP_012039555.1.36461 WP_012039555.1.38469 WP_012039555.1.56944 WP_012039555.1.64112 WP_012039555.1.71501 WP_012039555.1.75151 WP_012039555.1.80587 WP_012039555.1.8140 WP_012039555.1.84123 WP_012039555.1.88496 WP_012039555.1.97611 31964.CMS_2183 443906.CMM_2867 gi|148274051|ref|YP_001223612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]