SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0158
Domain Number 1 Region: 62-154
Classification Level Classification E-value
Superfamily VPA0735-like 0.0000327
Family VPA0735-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0158
Sequence length 165
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MKRRLLPALLPLALAACSQKGIEGLKTFDYSGGDERSGSLVYAETPPVGGPHNALWQTCG
VYDRPLYNEYAVHSLAHGAVWITYRPDLGPEGVAALRQLLNGYPATLLSPYPGLPAPVVV
SAWNAQLAVDAPDDRRLKAFLDRYGQGETAPERGAPCSGGYGGTR
Download sequence
Identical sequences Q1J223
319795.Dgeo_0158 gi|94984266|ref|YP_603630.1| WP_011529308.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]