SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0570
Domain Number 1 Region: 26-289
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.76e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000125
Further Details:      
 
Domain Number 2 Region: 290-414
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.25e-35
Family Anticodon-binding domain of Class II aaRS 0.0000599
Further Details:      
 
Domain Number 3 Region: 419-497
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1e-20
Family C-terminal domain of ProRS 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0570
Sequence length 497
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MPPMTKAEGKQDKKAQQYGVTPQSVDFNDWYNEVVKKADLADNSPVAGAMVVKPYGTALW
ENIQRWLDDRFKATGHESLIFPTLIPMNFITKEADHVEGFAPELFTVDRIGTEQLTEPYV
LRPTSETIIGYMWSGWLNSYRDLPFLHYQWGSVFRAELRTKAFLRTSEFYWHEGHTAHAS
EEEARREVRQILDLYHEFCRDILALPVVRGEKTASERFAGAVATYSIEGMMRDGKALQSG
TSHYLGQNFSKAFDVKFQTREQREEYAYTTSWAISSRIIGAIIMTHGDDFGLIMPPRIAP
IQVVVIPVSRKENFDQMVAEGEKLAHELRAQGLRVKVDRREGVTNGFKYNDWELKGVPVR
IELGPRDLEQGVVVVKNRNAEEKETLPREEAIRGMANRLDSIHNWLLQRATDFLLTHTVP
ADSYEELKNAIEHGNWVRAFHCGNAECEAQIKEDTKATTRNIPLDDAEFFNEREEGVCVK
CGQPSAYGKRVIFGRQY
Download sequence
Identical sequences Q1J0W2
gi|94984677|ref|YP_604041.1| 319795.Dgeo_0570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]