SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_0688 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_0688
Domain Number 1 Region: 3-432
Classification Level Classification E-value
Superfamily L-aspartase-like 4.4e-123
Family L-aspartase/fumarase 0.00000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_0688
Sequence length 435
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MIDRYLTPEMKLLWSEASRYRAWLKVELAAMEAQARQGEVPREAFEALSTRAAADPLDEA
FAVRVAEIEAVTRHDIVAFTRALTERYGEEARFIHHGLTSTDVVDTAQNLLLDEALNIIQ
EDVRALREVCRTQAVTHKHTPVVGRTHGIHAEPMTFGLKFLNWMATLDRDLERLHAARER
IRVVMLSGSVGTYAHISPRIEEEVAAAWGWQPAPITNQTLARDRHAEVLAALAILGTTLE
KIAVEIRHLQRSEVREAMEPFGQGQTGSSSMPHKKNPILTENVTGLSRLLRGHLVTGLEN
VALWHERDISHSSAERVILPDATAAASYATRRLTGVLRDLVVFPERMLRNLNDLGGLVFS
QRVLHALIDEKGLSREAAYDLVQRNALRSWETGEGLRDLLRADPTNPLSEAELDAAFDLG
WYLRHVEDIYARFGL
Download sequence
Identical sequences Q1J0J4
WP_011529831.1.71355 319795.Dgeo_0688 gi|94984795|ref|YP_604159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]