SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_1873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_1873
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.97e-51
Family Cold shock DNA-binding domain-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_1873
Sequence length 136
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MTLPTTQQLLRKGRTTLQKKSKVPALKGSPFRRGVCTVVKTTTPKKPNSALRKIARVRLS
SGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTQGVKDRNKSRSKYG
TKKPKAGAAAAGAKKK
Download sequence
Identical sequences 319795.Dgeo_1873 gi|94985973|ref|YP_605337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]