SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_1957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_1957
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000235
Family Multidrug resistance efflux transporter EmrE 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_1957
Sequence length 112
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MTAALALLCLAGAAGLDLFANLLLKASDGFRRPLPGLAALTLVLCAFGLLGLSLHTVPLS
VAYAVWGGLGIIGAALLSRRLEGVRFTPRAWLGLALILGSVAVLHLAEGSQS
Download sequence
Identical sequences Q1IWY3
gi|94986056|ref|YP_605420.1| 319795.Dgeo_1957 2005429801 WP_011531078.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]