SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_2822 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_2822
Domain Number 1 Region: 98-264
Classification Level Classification E-value
Superfamily SIS domain 4.45e-32
Family mono-SIS domain 0.0048
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000118
Family RpiR-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_2822
Sequence length 290
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MATPPAHLPPVLRRLHLLREEQGAATVRVIDQILMDPERFLSLTIAELSEAAGTSDATVV
RLVQHLGFGGYQEFKLQLSRALAVSRKADLTVEPQDASVTILRKIFDSSNTALDDTLEHL
NLEAFSAAVQAMTLARHIELIGMGASGVVALSGQYRGLRLGLSCRASTDPGTFLSTCSLL
EPTDVLIAVSFSGTRPQVVQAARLARQAGAIVVALTGLGRTPLSKVVHHTLTVSAPGDRY
RPEGLATQIPQVAILDALFTSLHVAQDPYLSERLSRAAAARRALNAEPSP
Download sequence
Identical sequences Q1J2N3
319795.Dgeo_2822 gi|94972285|ref|YP_594325.1| WP_011525757.1.71355 gi|94972285|ref|YP_594325.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]