SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321314.SC3876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321314.SC3876
Domain Number 1 Region: 6-325
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.1e-128
Family UbiD middle domain-like 0.00000000000945
Further Details:      
 
Domain Number 2 Region: 326-489
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.83e-66
Family UbiD C-terminal domain-like 0.0000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 321314.SC3876
Sequence length 492
Comment (Salmonella enterica Choleraesuis)
Sequence
MDAMKYHDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGGPALLFENPKGYAM
PVLCNLFGTPKRVAMGMGQDDVSALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNM
PTKRLRGAPCQQKIASGDDVDLTRLPVMTCWPDDAAPLITWGLTVTRGPHKERQNLGIYR
QQLIGKNKLIMRWLSHRGGALDFQEWLAAHPGERFPVSVALGADPATILGAVTPVPDTLS
EYAFAGLLRGTKTEVVKCLSNDLEVPASAEIILEGYIEPGEMAPEGPYGDHTGYYNEVDN
FPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEG
CSYRLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTR
MDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIVKDPEVTAR
IDAIWDELAIFK
Download sequence
Identical sequences C0Q3E9 Q57HN0
gi|224585793|ref|YP_002639592.1| AE017220|CDS_4117830-4119308 CP000857|CDS_4157190-4158668 WP_000339758.1.15468 WP_000339758.1.15637 WP_000339758.1.17758 WP_000339758.1.22270 WP_000339758.1.32493 WP_000339758.1.36948 WP_000339758.1.44943 WP_000339758.1.50497 WP_000339758.1.50777 WP_000339758.1.5527 WP_000339758.1.57902 WP_000339758.1.60486 WP_000339758.1.71418 WP_000339758.1.76162 WP_000339758.1.99426 321314.SC3876 476213.SPC_4086 gi|62182446|ref|YP_218863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]